Difference between revisions of "Lab Journal Hemochromatosis Task9"
(→Structure Selection) |
(→Structure Selection) |
||
Line 2: | Line 2: | ||
For the calculation of the coverage, the signal peptide at the beginning was omitted: <br> |
For the calculation of the coverage, the signal peptide at the beginning was omitted: <br> |
||
− | (275(length of sequence used in crystallisation) - 3(missing residues)) / (348(length of Q30201) - 22 (length of signal peptide)) |
+ | coverage= (275(length of sequence used in crystallisation) - 3(missing residues)) / (348(length of Q30201) - 22 (length of signal peptide)) |
== 3D mutations with SCWRL4 == |
== 3D mutations with SCWRL4 == |
Revision as of 14:28, 1 September 2013
Contents
Structure Selection
For the calculation of the coverage, the signal peptide at the beginning was omitted:
coverage= (275(length of sequence used in crystallisation) - 3(missing residues)) / (348(length of Q30201) - 22 (length of signal peptide))
3D mutations with SCWRL4
First, the wild type sequence was extracted from the FASTA entry of 1A6Z on rcsb.org. Then, using mut_seq.py, all mutant sequences were generated. The mutated structures were then generated with SCWRL4 using the following command
Scwrl4 -i <1a6z chain A pdb file> -o <mutated pdb> -s <mutated sequence file>
To check, whether only the right residue was mutated, the sequence of the PDB files containing the mutations were extracted and compared:
RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTYQVEHPGLDQPLIVIW RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDDESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHIFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW RSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVISSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW RSHSLHYLFMGASEQDLGLSLFEALGYMDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIW
3D mutations with FoldX
FoldX was run with modified scripts from the tutorial page of FoldX.
Minimisation
The minimisation was carried out on the student machines with the following command
/opt/SS12-Practical/minimise/minimise <inPDB> <outPDB> > <logfile>
1 kJ = 0.239 kcal
mut_seq.py
<source lang="python"> import copy seq="rllrshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwlqlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdhlefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvldqqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgtyqgwitlavppgeeqrytcqvehpgldqpliviw" seq= list(seq)
mut = {53:"M",63:"D",97:"I",217:"I",282:"Y"}
for key in mut.iterkeys(): mut_seq = copy.deepcopy(seq) mut_seq[key-23] = mut[key] ## -(22+1) 22 for PDB - seq offset and 1 for indexing starting at 0 fName= str(key) + mut[key] + ".seq" with open(fName,"w+") as f: f.write("".join(mut_seq[3:])) #leave out first three residues because they are missing in the PDB structure
</source>
min_structures.sh
<source lang="bash">
fx=./foldx/*.pdb
for f in $fx do base=${f%.*} mkdir $base
/opt/SS12-Practical/minimise/minimise $f $base/iter1.pdb > $base/iter1.out
for i in 2 3 4 5 do p=$(($i-1)) /opt/SS12-Practical/minimise/minimise $base/iter$p.pdb $base/iter$i.pdb > $base/iter$i.out done
done </source>
get_res.py
<source lang="python"> import sys import os from collections import defaultdict
folder = sys.argv[1]
mutNames = os.listdir(folder) eList = defaultdict(list) for mut in sorted(mutNames): if not mut.endswith(".pdb"): continue mFolder = folder + "/" + mut[:-4] for i in range(1,6): fName = mFolder + "/iter"+ str(i) + ".out" with open(fName) as f: t = f.readlines() energy = t[-6].strip()[7:].strip(")") energy = str(round(float(energy),2)) eList[mut[:-4]].append(energy)
for mut in sorted(eList.keys()):
eList[mut].insert(0,mut)
print "| " + " || ".join(eList[mut])
print "|-"
</source>