Difference between revisions of "Canavan Disease"

From Bioinformatikpedia
Line 35: Line 35:
   
 
== Disease mechanism ==
 
== Disease mechanism ==
  +
 
[[Image:ASPA.jpg|thumb|450px|Crystal structure of aspartoacylase (source: PDB)]]
 
[[Image:ASPA.jpg|thumb|450px|Crystal structure of aspartoacylase (source: PDB)]]
 
Canavan Disease belongs to the group of leukodystrophies. This comes from greek: λευκος ''leukos'' "white", δυς ''dys'' "bad, wrong", τροφη ''trophae'' "feeding, growth". This is a genetic induced metabolic disorder, which affects the white matter of the nervous system. If the white matter is not properly grown, the myelin, which surrounds the nerve cells for protection, is degraded. Therefore it may have an effect on the nerves itsself. <br>
 
Canavan Disease belongs to the group of leukodystrophies. This comes from greek: λευκος ''leukos'' "white", δυς ''dys'' "bad, wrong", τροφη ''trophae'' "feeding, growth". This is a genetic induced metabolic disorder, which affects the white matter of the nervous system. If the white matter is not properly grown, the myelin, which surrounds the nerve cells for protection, is degraded. Therefore it may have an effect on the nerves itsself. <br>
Line 48: Line 49:
   
 
==== Prenatal Diagnosis ====
 
==== Prenatal Diagnosis ====
  +
 
There are several types of prenatal testing possibilities depending whether the carrier status of both parents is known or not. For couples where it is only known that one of the parents is a carrier and the remaining parent’s status is not known, normally testing is done by measuring the concentration of N-acetyl-L-aspartic acid (NAA) in the amniotic fluid within the time between the 16th and 18th week of pregnancy.
 
There are several types of prenatal testing possibilities depending whether the carrier status of both parents is known or not. For couples where it is only known that one of the parents is a carrier and the remaining parent’s status is not known, normally testing is done by measuring the concentration of N-acetyl-L-aspartic acid (NAA) in the amniotic fluid within the time between the 16th and 18th week of pregnancy.
 
Another possibility is molecular genetic testing. Following this method an analysis of DNA extracted from fetal cells is done. These fetal cells are obtained either between the tenth to 12th week of pregnancy by chorionic villus (“proto-”placental tissue that has the same genetic material as the fetus) sampling or between the 15th and 18th week by amniocentesis, also known as amniotic fluid testing (AFT). However for the molecular genetic testing both disease causing genes of the parents have to be identified first.
 
Another possibility is molecular genetic testing. Following this method an analysis of DNA extracted from fetal cells is done. These fetal cells are obtained either between the tenth to 12th week of pregnancy by chorionic villus (“proto-”placental tissue that has the same genetic material as the fetus) sampling or between the 15th and 18th week by amniocentesis, also known as amniotic fluid testing (AFT). However for the molecular genetic testing both disease causing genes of the parents have to be identified first.
   
 
==== Neonatal / Infantile Diagnosis ====
 
==== Neonatal / Infantile Diagnosis ====
  +
 
Postnatal testing for Canavan Disease can as well be done in several ways. One possibility is to test for a raised N-acetyl-L-aspartic acid (NAA) concentration in urine, blood and cerebrospinal fluid (CSF) (comparable to prenatal testing with the carrier status of one parent not known).
 
Postnatal testing for Canavan Disease can as well be done in several ways. One possibility is to test for a raised N-acetyl-L-aspartic acid (NAA) concentration in urine, blood and cerebrospinal fluid (CSF) (comparable to prenatal testing with the carrier status of one parent not known).
 
Other possibilities may be cultivating skin fibroblasts and test them for reduced aspartoacylase activity, perform neuroimaging of the brain and look for spongy degeneration, or test the gene itself for a defect in the newborn child. However it takes between three to nine months after birth until most of the symptoms become apparent.
 
Other possibilities may be cultivating skin fibroblasts and test them for reduced aspartoacylase activity, perform neuroimaging of the brain and look for spongy degeneration, or test the gene itself for a defect in the newborn child. However it takes between three to nine months after birth until most of the symptoms become apparent.
   
 
==== Mild / Juvenile Diagnosis ====
 
==== Mild / Juvenile Diagnosis ====
  +
 
Diagnosing a patient with Canavan Disease if he is suffering from a mild or juvenile form, is a bit more challenging, as the postnatal diagnosis methods, except testing the gene itself, won't yield in a satisfactory result or may even overlook the disease completely. The concentration of NAA may be elevated only slightly and not as significant such that a proper diagnosis can be made. The same being true for the results of neuroimaging, and the mild developmental delay that is a result of Canavan Disease which can simply go unrecognized.
 
Diagnosing a patient with Canavan Disease if he is suffering from a mild or juvenile form, is a bit more challenging, as the postnatal diagnosis methods, except testing the gene itself, won't yield in a satisfactory result or may even overlook the disease completely. The concentration of NAA may be elevated only slightly and not as significant such that a proper diagnosis can be made. The same being true for the results of neuroimaging, and the mild developmental delay that is a result of Canavan Disease which can simply go unrecognized.
   
Line 64: Line 68:
   
 
==== Prenatal Treatment ====
 
==== Prenatal Treatment ====
  +
 
There is a possibility of prenatal screening to check whether or not you are a carrier of the disease (as described in the section before). Other prenatal treatments are under investigation and depend on animal models.
 
There is a possibility of prenatal screening to check whether or not you are a carrier of the disease (as described in the section before). Other prenatal treatments are under investigation and depend on animal models.
   
 
==== Neonatal / Infantile Treatment ====
 
==== Neonatal / Infantile Treatment ====
  +
 
Since Canavan also affects the metabolism there is need to control the nutrition and hydration. This includes specialized food to make up for missing metabolites and nutrients as well as different ways of feeding / providing nutrition to the child to prevent problems arising from swallowing difficulties and other physical disabilities. To improve those physical disabilities and muscle problems, it is recommended that children need physical therapy. Additionally there are antiepileptic drugs against seizures and spastic behaviour.
 
Since Canavan also affects the metabolism there is need to control the nutrition and hydration. This includes specialized food to make up for missing metabolites and nutrients as well as different ways of feeding / providing nutrition to the child to prevent problems arising from swallowing difficulties and other physical disabilities. To improve those physical disabilities and muscle problems, it is recommended that children need physical therapy. Additionally there are antiepileptic drugs against seizures and spastic behaviour.
   
 
==== Mild / Juvenile Treatment ====
 
==== Mild / Juvenile Treatment ====
  +
 
Since mild and juvenile Canavan patients only have some delays in the development and speech, a speech therapy may be useful. Further deep medical care is not necessary.
 
Since mild and juvenile Canavan patients only have some delays in the development and speech, a speech therapy may be useful. Further deep medical care is not necessary.
   
 
== Future Work ==
 
== Future Work ==
  +
 
There are some clinical trials and animal models under investigation to find a cure for canavan disease.
 
There are some clinical trials and animal models under investigation to find a cure for canavan disease.
   
 
==== Gene Therapy ====
 
==== Gene Therapy ====
  +
 
There were several studies in the gene therapy, using viral and nonviral vectors to transfer genes into the patients that were thought to improve the course of the disease. However none of children showed an improvement and the disease showed a development similar to an untreated patient.
 
There were several studies in the gene therapy, using viral and nonviral vectors to transfer genes into the patients that were thought to improve the course of the disease. However none of children showed an improvement and the disease showed a development similar to an untreated patient.
   
 
==== Lithium Citrate as Pharmaceutical ====
 
==== Lithium Citrate as Pharmaceutical ====
  +
 
Since N-acetyl-L-aspartate (NAA) is one important factor in the biochemical background of Canavan Disease, where the NAA level is too high, lithium citrate may be able to reduce the NAA concentration. Rat models have shown that treating a rat with lithium citrate resulted in a reduced level of NAA. Furthermore if the drug is administered to a human the same effect can be observed with a return to elevated NAA concentration when the lithium citrated is washed out of the body after roughly 2 weeks. However so far no larger controlled clinical studies have been conducted, but lithium citrate shows a potential treatment that is worth pursuing.
 
Since N-acetyl-L-aspartate (NAA) is one important factor in the biochemical background of Canavan Disease, where the NAA level is too high, lithium citrate may be able to reduce the NAA concentration. Rat models have shown that treating a rat with lithium citrate resulted in a reduced level of NAA. Furthermore if the drug is administered to a human the same effect can be observed with a return to elevated NAA concentration when the lithium citrated is washed out of the body after roughly 2 weeks. However so far no larger controlled clinical studies have been conducted, but lithium citrate shows a potential treatment that is worth pursuing.
   
 
==== Animal Models ====
 
==== Animal Models ====
  +
 
Several gen models in knockout mice and rats have been studied, with lithium citrate and an enzyme replacement therapy showing the best result so far and therefore being the most promising at the moment.
 
Several gen models in knockout mice and rats have been studied, with lithium citrate and an enzyme replacement therapy showing the best result so far and therefore being the most promising at the moment.
   
   
 
== Gene, Mutations ==
 
== Gene, Mutations ==
  +
 
[[Image:ASPA gene location.png|thumb|750px|Chromosome 17 with highlighted position of ASPA-gene (source: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASPA)]]
 
[[Image:ASPA gene location.png|thumb|750px|Chromosome 17 with highlighted position of ASPA-gene (source: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASPA)]]
 
The ASPA gene sits on chromosome 17 on the p-arm (upper part, short arm) band 1 subband 3 subsubband 2 (short 17p13.2).
 
The ASPA gene sits on chromosome 17 on the p-arm (upper part, short arm) band 1 subband 3 subsubband 2 (short 17p13.2).
Line 94: Line 106:
   
 
=== Reference sequence ===
 
=== Reference sequence ===
  +
 
DEFINITION Homo sapiens aspartoacylase (ASPA), transcript variant 1, mRNA.
 
DEFINITION Homo sapiens aspartoacylase (ASPA), transcript variant 1, mRNA.
 
TITLE Expression of aspartoacylase (ASPA) and Canavan disease
 
TITLE Expression of aspartoacylase (ASPA) and Canavan disease

Revision as of 16:17, 19 April 2013

Working copy - not yet complete!!

Summary

Canavan Disease is an autosomal recessive disorder, in which a dysfunctional enzyme causes severe brain damage. It is also known under a variety of other names describing the the chemical basis or phenotype of the disease. Examples are "Spongy Degeneration Of Central Nervous System", "Aspartoacylase (ASPA) Deficiency", or "Aminoacylase 2 (ACY2) Deficiency". The trivial name, Canavan Disease, stems from the name of Myrtelle Canavan (1879 – 1953), an american physician that first described the disease in 1931. There is no cure and almost all patients die within the first decade of their life. The mild / juvenile type is less severe. The treatment is based on the symptoms and supportive.

Inheritance

Canavan disease is an autosomal recessive genetic defect of the ASPA (Aspartoacyclase) gene on chromosome 17. With this pattern of heritage a newborn of a couple where both parents are carriers of the defective genome has a 25% chance neither being born suffering from Canavan Disease nor being born a carrier. For some time children born of Ashkenazi Jewish ancestry had a higher prevalence of having Canavan Disease while in the last years this prevalence is sinking due to ongoing prenatal screening programs. Other ethnic groups where Canavan Disease has a higher penetrance are for example populations of Saudi Arabian ancestry. !!! prevalence !!!

Phenotype

Canavan Disease has a variety of different phenotypes all over the body. Here is a short overview:

  • Head
    • macrocephaly (increased head circumference)
    • mental retardation and impairment (losing mental skills)
    • losing ability to move head
  • Eyes
    • becoming blind
    • nystagmus (greek: νυσταζω nytaxoo "sleep, nod", german: "Augenzittern")
  • Ears
    • becoming deaf
  • Mouth
    • problems with swallowing
    • losing communicational abilities (cannot talk, stay quiet)
  • Body
    • paralysis
    • seizures
    • problems moving the muscles

Children suffering from Canavan Disease usually die within the first dacade. In the mild/juvenile form of Canavan Disease, the children usually have some developmental delay and some speech problems.


Disease mechanism

Crystal structure of aspartoacylase (source: PDB)

Canavan Disease belongs to the group of leukodystrophies. This comes from greek: λευκος leukos "white", δυς dys "bad, wrong", τροφη trophae "feeding, growth". This is a genetic induced metabolic disorder, which affects the white matter of the nervous system. If the white matter is not properly grown, the myelin, which surrounds the nerve cells for protection, is degraded. Therefore it may have an effect on the nerves itsself.
The concrete biochemical background is the following: The enzyme aspartoacylase (ASPA) depends on the gene product of the ASPA gene. The enzyme decomposes N-acetyl-L-aspartate (NAA). Components of NAA are needed for the formation of the myelin sheath around the nerve fibers. Another sideeffect is that the degenerated white matter leaves several soft tissue or even complete spaces behind.

Alanine, Aspartate and Glutamate Metabolism (source: KEGG) highlighting disease associated enzymes

Diagnosis

There are a couple of possibilities how and when an affected patient is diagnosed with Canavan Disease. The time points are prenatal, postnatal, and when a mild or juvenile form of Canavan Disease is already present. Nevertheless one of the most important things to know beforehand is if both parents carry one copy of the disease causing gene. This can be done by simple DNA testing.

Prenatal Diagnosis

There are several types of prenatal testing possibilities depending whether the carrier status of both parents is known or not. For couples where it is only known that one of the parents is a carrier and the remaining parent’s status is not known, normally testing is done by measuring the concentration of N-acetyl-L-aspartic acid (NAA) in the amniotic fluid within the time between the 16th and 18th week of pregnancy. Another possibility is molecular genetic testing. Following this method an analysis of DNA extracted from fetal cells is done. These fetal cells are obtained either between the tenth to 12th week of pregnancy by chorionic villus (“proto-”placental tissue that has the same genetic material as the fetus) sampling or between the 15th and 18th week by amniocentesis, also known as amniotic fluid testing (AFT). However for the molecular genetic testing both disease causing genes of the parents have to be identified first.

Neonatal / Infantile Diagnosis

Postnatal testing for Canavan Disease can as well be done in several ways. One possibility is to test for a raised N-acetyl-L-aspartic acid (NAA) concentration in urine, blood and cerebrospinal fluid (CSF) (comparable to prenatal testing with the carrier status of one parent not known). Other possibilities may be cultivating skin fibroblasts and test them for reduced aspartoacylase activity, perform neuroimaging of the brain and look for spongy degeneration, or test the gene itself for a defect in the newborn child. However it takes between three to nine months after birth until most of the symptoms become apparent.

Mild / Juvenile Diagnosis

Diagnosing a patient with Canavan Disease if he is suffering from a mild or juvenile form, is a bit more challenging, as the postnatal diagnosis methods, except testing the gene itself, won't yield in a satisfactory result or may even overlook the disease completely. The concentration of NAA may be elevated only slightly and not as significant such that a proper diagnosis can be made. The same being true for the results of neuroimaging, and the mild developmental delay that is a result of Canavan Disease which can simply go unrecognized.


Treatment

Right now there is no cure for Canavan Disease, but there are treatments depending on the symptoms, which work in a supportive manner.

Prenatal Treatment

There is a possibility of prenatal screening to check whether or not you are a carrier of the disease (as described in the section before). Other prenatal treatments are under investigation and depend on animal models.

Neonatal / Infantile Treatment

Since Canavan also affects the metabolism there is need to control the nutrition and hydration. This includes specialized food to make up for missing metabolites and nutrients as well as different ways of feeding / providing nutrition to the child to prevent problems arising from swallowing difficulties and other physical disabilities. To improve those physical disabilities and muscle problems, it is recommended that children need physical therapy. Additionally there are antiepileptic drugs against seizures and spastic behaviour.

Mild / Juvenile Treatment

Since mild and juvenile Canavan patients only have some delays in the development and speech, a speech therapy may be useful. Further deep medical care is not necessary.

Future Work

There are some clinical trials and animal models under investigation to find a cure for canavan disease.

Gene Therapy

There were several studies in the gene therapy, using viral and nonviral vectors to transfer genes into the patients that were thought to improve the course of the disease. However none of children showed an improvement and the disease showed a development similar to an untreated patient.

Lithium Citrate as Pharmaceutical

Since N-acetyl-L-aspartate (NAA) is one important factor in the biochemical background of Canavan Disease, where the NAA level is too high, lithium citrate may be able to reduce the NAA concentration. Rat models have shown that treating a rat with lithium citrate resulted in a reduced level of NAA. Furthermore if the drug is administered to a human the same effect can be observed with a return to elevated NAA concentration when the lithium citrated is washed out of the body after roughly 2 weeks. However so far no larger controlled clinical studies have been conducted, but lithium citrate shows a potential treatment that is worth pursuing.

Animal Models

Several gen models in knockout mice and rats have been studied, with lithium citrate and an enzyme replacement therapy showing the best result so far and therefore being the most promising at the moment.


Gene, Mutations

Chromosome 17 with highlighted position of ASPA-gene (source: http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASPA)

The ASPA gene sits on chromosome 17 on the p-arm (upper part, short arm) band 1 subband 3 subsubband 2 (short 17p13.2). Disease causing mutations: Glu285Ala, Tyr231X, and Ala305Glu -nucleic changes: see table


Reference sequence

DEFINITION Homo sapiens aspartoacylase (ASPA), transcript variant 1, mRNA. TITLE Expression of aspartoacylase (ASPA) and Canavan disease NCBI Reference Sequence: NM_000049.2

>sp|P45381|ACY2_HUMAN Aspartoacylase OS=Homo sapiens GN=ASPA PE=1 SV=1 MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK LTLNAKSIRCCLH

http://www.rcsb.org/pdb/explore/explore.do?structureId=2I3C

>2I3C:A|PDBID|CHAIN|SEQUENCE AIATSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENL GKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIE HPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGE IAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH >2I3C:B|PDBID|CHAIN|SEQUENCE AIATSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENL GKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIE HPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGE IAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH


References

http://en.wikipedia.org/wiki/Myrtelle_Canavan http://ghr.nlm.nih.gov/condition/canavan-disease https://www.counsyl.com/diseases/canavan-disease/ http://omim.org/entry/608034 http://omim.org/entry/271900 http://www.uniprot.org/uniprot/P45381


pic: aspa gene : http://www.genecards.org/cgi-bin/carddisp.pl?gene=ASPA