Difference between revisions of "CD task2 protocol"
(→HHBlits) |
(→PsiBlast) |
||
Line 29: | Line 29: | ||
<b>2 iterations, more strict E-value cutoff of 10E-10 </b> |
<b>2 iterations, more strict E-value cutoff of 10E-10 </b> |
||
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_h10e10_p45381_wt_big80.out -j 2 -h 10e-10 </source> |
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_h10e10_p45381_wt_big80.out -j 2 -h 10e-10 </source> |
||
+ | |||
+ | <b>GO Term Enrichment (all terms represented more than once)</b> |
||
+ | hydrolase activity, acting on ester bonds 766 |
||
+ | metabolic process 665 |
||
+ | hydrolase activity 507 |
||
+ | metal ion binding 488 |
||
+ | zinc ion binding 294 |
||
+ | arginine catabolic process to glutamate 234 |
||
+ | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides 176 |
||
+ | aspartoacylase activity 158 |
||
+ | arginine metabolic process 132 |
||
+ | succinylglutamate desuccinylase activity 132 |
||
+ | cytoplasm 30 |
||
+ | arginine catabolic process to succinate 24 |
||
+ | proteolysis 23 |
||
+ | metallocarboxypeptidase activity 22 |
||
+ | apical plasma membrane 12 |
||
+ | carboxypeptidase activity 9 |
||
+ | nucleus 8 |
||
+ | aminoacylase activity 8 |
||
+ | membrane 8 |
||
+ | identical protein binding 6 |
||
+ | oxidation-reduction process 6 |
||
+ | plasma membrane 6 |
||
+ | oxidoreductase activity 5 |
||
+ | malate synthase activity 2 |
||
+ | glyoxylate cycle 2 |
||
+ | exonuclease activity 2 |
||
+ | nucleotide binding 2 |
||
+ | acetate metabolic process 2 |
||
+ | arginine catabolic process 2 |
||
+ | cell adhesion 2 |
||
+ | virus-host interaction 2 |
||
+ | integral to membrane 2 |
||
+ | transferase activity 2 |
||
+ | |||
+ | |||
Revision as of 11:59, 24 August 2012
Contents
Sequence
The native ASPA sequence (UniProt: P45381):
>hsa:443 ASPA, ACY2, ASP; aspartoacylase; K01437 aspartoacylase [EC:3.5.1.15] (A) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK LTLNAKSIRCCLH
BlastP
We ran BlastP on student machines with the big_80 as a reference database.
<source lang="bash"> blastall -p blastp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o blastp_p45381_wt_big80.out </source>
PsiBlast
PSIBlast was used in the same fashion as BLAST, with the big_80 as the background database.
2 iterations and default E-Value 0.002 <source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_p45381_wt_big80.out -j 2 -v 700</source>
2 iterations, more strict E-value cutoff of 10E-10
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it2_h10e10_p45381_wt_big80.out -j 2 -h 10e-10 </source>
GO Term Enrichment (all terms represented more than once)
hydrolase activity, acting on ester bonds 766 metabolic process 665 hydrolase activity 507 metal ion binding 488 zinc ion binding 294 arginine catabolic process to glutamate 234 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides 176 aspartoacylase activity 158 arginine metabolic process 132 succinylglutamate desuccinylase activity 132 cytoplasm 30 arginine catabolic process to succinate 24 proteolysis 23 metallocarboxypeptidase activity 22 apical plasma membrane 12 carboxypeptidase activity 9 nucleus 8 aminoacylase activity 8 membrane 8 identical protein binding 6 oxidation-reduction process 6 plasma membrane 6 oxidoreductase activity 5 malate synthase activity 2 glyoxylate cycle 2 exonuclease activity 2 nucleotide binding 2 acetate metabolic process 2 arginine catabolic process 2 cell adhesion 2 virus-host interaction 2 integral to membrane 2 transferase activity 2
10 iterations, default Evalue 0.002 <source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_p45381_wt_big80.out -j 10 </source>
10 iterations, E-value cutoff 10E-10
<source lang="bash"> blastpgp -d /mnt/project/pracstrucfunc12/data/big/big_80 -i P45381_wt.fasta -o psiblast_it10_h10e10_p45381_wt_big80.out -j 10 -h 10e-10 </source>
HHBlits
Run HHBlits on student machines with Uniprot20 database.
- 2 iterations
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -o hhblits_p45381_def.out </source>
- 8 iterations
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -z 1000 -v 1000-o hhblits_p45381_n10.out </source>
- 2 iterations, -e 10e-10
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -e 10e-10 -o hhblits_p45381_def.out </source>
- 8 iterations, -e 10e-10
<source lang="bash"> hhblits -i P45381_wt.fasta -d /mnt/project/pracstrucfunc12/data/hhblits/uniprot20_current -n 8 -e 10e-10 -z 1000 -v 1000 -o hhblits_p45381_n10.out </source>