Difference between revisions of "CD task4 protocol"
(→Target) |
(→I-Tasser) |
||
Line 69: | Line 69: | ||
= I-Tasser = |
= I-Tasser = |
||
+ | |||
+ | C-score is a confidence score for estimating the quality of predicted models by I-TASSER. It is calculated |
||
+ | based on the significance of threading template alignments and the convergence parameters of the structure |
||
+ | assembly simulations. C-score is typically in the range of [-5,2], where a C-score of higher value signifies |
||
+ | a model with a high confidence and vice-versa. |
||
+ | |||
==Template > 80% Seq Id: 2GU2 (Rattus Norvegicus)== |
==Template > 80% Seq Id: 2GU2 (Rattus Norvegicus)== |
||
For the > 80% sequence identity template, we used default values, simply providing the template identifier 2GU2 and Chain A for modelling. |
For the > 80% sequence identity template, we used default values, simply providing the template identifier 2GU2 and Chain A for modelling. |
Revision as of 14:40, 6 June 2012
Contents
Modeller
We modified the scripts provided in the tutorial to suit our demands.
Target
The sequence of out target Aspartoacylase saved in .pir format:
>P1;p45381 sequence:p45381:::::::0.00: 0.00 MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK LTLNAKSIRCCLH*
Alignment
Example alignment script for creating the pairwise alignment of 2GU2 and Aspa.
from modeller import * env = environ() # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## o$ aln = alignment(env) mdl = model(env, file='2GU2', model_segment=('FIRST:A', 'END:A')) aln.append_model(mdl, align_codes='2GU2', atom_files='2GU2') aln.append(file='../p45381.pir', align_codes='p45381') aln.align2d() aln.check() aln.write(file='aspa_2gu2-2d.ali', alignment_format='PIR') aln.malign() aln.check() aln.write(file='aspa_2gu2.ali', alignment_format='PIR')
Single template modelling
Example alignment script for creating a model of Aspartoacylase from a single template 2GU2:A.
from modeller import * from modeller.automodel import * log.verbose() env = environ() # env.io.atom_files_directory = ["/apps/modeller9.9/bin/examples/commands/", "/path/to/your/files/"] ## only needed in the VirtualBox a = automodel(env, alnfile = 'aspa_2gu2-2d.ali', knowns = '2GU2A', sequence = 'p45381', assess_methods=(assess.DOPE, assess.GA341)) a.starting_model= 1 a.ending_model = 1 a.make()
Alignments for different templates
2GU2 | <figure id="2gu2_align"></figure> |
3NFZ | <figure id="3nfz_align"></figure> |
I-Tasser
C-score is a confidence score for estimating the quality of predicted models by I-TASSER. It is calculated based on the significance of threading template alignments and the convergence parameters of the structure assembly simulations. C-score is typically in the range of [-5,2], where a C-score of higher value signifies a model with a high confidence and vice-versa.
Template > 80% Seq Id: 2GU2 (Rattus Norvegicus)
For the > 80% sequence identity template, we used default values, simply providing the template identifier 2GU2 and Chain A for modelling.