Difference between revisions of "ASPA Sequence Based Predictions"

From Bioinformatikpedia
(JPred3)
(DSSP)
Line 77: Line 77:
   
 
===DSSP===
 
===DSSP===
  +
DSSP (Define Secondary Structure of Proteins) is a software for secondary structure assignment and was published in 1983 by Wolfgang Kabsch and Chris Sander.
  +
Reference: [http://onlinelibrary.wiley.com/doi/10.1002/bip.360221211/abstract Original paper]
  +
  +
DSSP does not predict secondary structure from amino acid sequences; instead, it uses a 3D structure (a PDB file) to deduce the secondary structure from the 3D structure. To this end, DSSP examines the phi and psi angles and the C alpha positions in the protein backbone and H-bonds present in the structure; these are used to define "n-turns", which are H-bonds between the NH and CO groups of amino acids with sequence separations of 3-5 residues, and "bridges" with greater sequence separations. Repeating 4-turns are used to identify helices, repeating bridges identify beta sheets.
  +
  +
Input: A 3D structure (a PDB file)
  +
  +
The results differ from those of the two secondary structure predictors, as the PDB file contains a dimer, whereas the Uniprot sequence only contains one domain (which is a sensible thing, since both domains are essentially identical.)
  +
  +
The prediction shows slight differences between both domains; we assume that reasons for this are slight differences in the actual 3D structure of the two chains as well as H-bonds between the two chains.
  +
 
<pre> 10 20 30 40 50 60
 
<pre> 10 20 30 40 50 60
 
| | | | | |
 
| | | | | |

Revision as of 00:27, 7 June 2011

Prediction of Secondary Structure Elements

PsiPred

PsiPred results for Aspartoacyclase
# PSIPRED HFORMAT (PSIPRED V3.0)

Conf: 987522213466199993246776008999999984450000587389976339987971
Pred: CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHHHH
  AA: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK
              10        20        30        40        50        60


Conf: 998788998878786647999999984999999999988199999997428994187898
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCC
  AA: CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
              70        80        90       100       110       120


Conf: 999505864599448999999998762999737862048886301220027861499667
Pred: CCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHCCCCCCEEEEEC
  AA: NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
             130       140       150       160       170       180


Conf: 877898808999999999999998976406998899973479998113515579877700
Pred: CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEEEECCCCCCCCCE
  AA: PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA
             190       200       210       220       230       240


Conf: 552467669998546888832213699778518622057770372000011102000100
Pred: EEECCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEEECCCCHHCCCCHHHEECCE
  AA: AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK
             250       260       270       280       290       300


Conf: 3544256113309
Pred: EEEEECCCEEECC
  AA: LTLNAKSIRCCLH
             310 

JPred3

JPred3 was published in 1998 by Christian Cole, Jonathan D. Barber and Geoffrey J. Barton.

Reference: Original paper, current version

JPred3 uses the JNet 2.0 algorithm to make its predictions. This algorithm generates profiles using PSI-Blast (which is used to build a position-specific scoring matrix) and HMMer (which is used to construct HMM profiles.) Both position-specific scoring matrix and the HMMs are used to predict secondary structure and solvent accessibility.

Input: A protein sequence or a pre-made MSA; a PDB database is needed, too, but provided by the JPred3 server.

MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYID
------------EEEEEEEE------HHHHHHHHHH---------EEEEEEEE-HHHHHH-----H



CDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSR
---------------------HHHHHHHHHHHHHH-------EEEEEE-----------EEEE---



NNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKM
-HHHHHHHHHHHH------EEEEEE---------HHEE----EEEEE---------HHHHHHHHHH



IKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLT
HHHHHHHHHHH----------EEEEEEEEEE----------EEEE----------------HHE--



LDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH
----EEEE----EEEEEEE-----HHH-HHHHHHHHEEE-----EEEE-

DSSP

DSSP (Define Secondary Structure of Proteins) is a software for secondary structure assignment and was published in 1983 by Wolfgang Kabsch and Chris Sander. Reference: Original paper

DSSP does not predict secondary structure from amino acid sequences; instead, it uses a 3D structure (a PDB file) to deduce the secondary structure from the 3D structure. To this end, DSSP examines the phi and psi angles and the C alpha positions in the protein backbone and H-bonds present in the structure; these are used to define "n-turns", which are H-bonds between the NH and CO groups of amino acids with sequence separations of 3-5 residues, and "bridges" with greater sequence separations. Repeating 4-turns are used to identify helices, repeating bridges identify beta sheets.

Input: A 3D structure (a PDB file)

The results differ from those of the two secondary structure predictors, as the PDB file contains a dimer, whereas the Uniprot sequence only contains one domain (which is a sensible thing, since both domains are essentially identical.)

The prediction shows slight differences between both domains; we assume that reasons for this are slight differences in the actual 3D structure of the two chains as well as H-bonds between the two chains.

                     10        20        30        40        50        60
                      |         |         |         |         |         |
    1 -   60 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCD
    1 -   60     SSSSSS TTTT HHHHHHHHHHTT  333  TT SSSSSST HHHHHTTTT TTT
    1 -   60
    1 -   60 AA AA               A  AA AAA AA AAAA A A     AA  AAAA AAAA
                     70        80        90       100       110       120
                      |         |         |         |         |         |
   61 -  120 LNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLIL
   61 -  120 333  THHHHTT   TTT HHHHHHHHHHHHH  TTTTTT TSSSSSSS TTT SSSSSS
   61 -  120       **  * * **            **   * *
   61 -  120   A  AAA  AAAAAAAAA   A   A  AA  AAA AA             A
                    130       140       150       160       170       180
                      |         |         |         |         |         |
  121 -  180 EDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLR
  121 -  180 T TT HHHHHHHHHHHHHHTTT SSSSS   TT     3333TTSSSSSSSST  TT
  121 -  180              *  ** **
  121 -  180  A A A      AA AAA AAAA A    AAAAAA        AA       A  A   A
                    190       200       210       220       230       240
                      |         |         |         |         |         |
  181 -  240 ADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQ
  181 -  240 HHHHHHHHHHHHHHHHHHHHHHTT     SSSSSSSSSSSS     TTT   TSS TTTT
  181 -  240
  181 -  240  A  AA AA  AA     AA  AAAA AA A A  A AAA A AAAAA A      AA
                    250       260       270       280       290       300
                      |         |         |         |         |         |
  241 -  300 DQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSI
  241 -  300 T TTT   TTTSSSS TT  SSS  TTT  SSSTTT 333TTTT TSSSSSSSSSSS
  241 -  300
  241 -  300 AA  AA AAAAA  A  AAAAAA AAAAA A          AAA    A  AAA A A


  301 -  302 RC
  301 -  302
  301 -  302
  301 -  302 AA
 
                  310       320       330       340       350       360
                    |         |         |         |         |         |
  303 -  362 EHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCD
  303 -  362     SSSSSS TTTT HHHHHHHHHHHH 3333  TT SSSSSST HHHHHTT T TTT
  303 -  362
  303 -  362 AA AA                  AA AAA AA AAAA A A A   AA  AAAA AAAA
                  370       380       390       400       410       420
                    |         |         |         |         |         |
  363 -  422 LNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLIL
  363 -  422 333  THHHHTT   TTT HHHHHHHHHHHHH  TTTTTT TSSSSSSS TTT SSSSSS
  363 -  422       **  ***  *            **    ****
  363 -  422   A  AAA  AAAAAAAAA   A   A  AA  AAA AA             A
                  430       440       450       460       470       480
                    |         |         |         |         |         |
  423 -  482 EDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLR
  423 -  482 T TT HHHHHHHHHHHHHHTTT SSSSS  TTTT    3333TTSSSSSSSS   TT
  423 -  482
  423 -  482  A A A      AA AA  AAAA A    AAAAAA        AA       A      A
                  490       500       510       520       530       540
                    |         |         |         |         |         |
  483 -  542 ADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQ
  483 -  542 HHHHHHHHHHHHHHHHHHHHHHTT     SSSSSSSSSSSS     TTT   TSS TTTT
  483 -  542                             *** *
  483 -  542  A  AA AA  A      AA  A AA AA A A  A AAA A AAAAA A A    AA
                  550       560       570       580       590       600
                    |         |         |         |         |         |
  543 -  602 DQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSI
  543 -  602 T TTT   TTTSSSS TT  SSS  TTT  SSSTTT THHHHTT TSSSSSSSSSSS
  543 -  602                                                        *
  543 -  602 AA  AA AAAAA  A  AAAAAA AAAAA A          AAA    A AAAA A AA


  603 -  604 RC
  603 -  604
  603 -  604
  603 -  604 AA

Clearly solvent accessible: A; involved in symmetry contacts: *

pdb id: 2o53

Prediction of disordered regions

DISOPRED

DISOPRED result graph for Aspartoacyclase
DISOPRED predictions for a false positive rate threshold of: 2%

conf: 999999999877640000000000000000000000000000000000000000000000
pred: **********..................................................
  AA: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK
              10        20        30        40        50        60

conf: 000000000000000356777788777654200000000000000000000000000000
pred: ......................**....................................
  AA: CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
              70        80        90       100       110       120

conf: 000000000000000000000000000000000000000000000000000000000000
pred: ............................................................
  AA: NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
             130       140       150       160       170       180

conf: 000000000000000000000000000000000000000000000000000000000000
pred: ............................................................
  AA: PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA
             190       200       210       220       230       240

conf: 000000000000000000000000000000000000000000000000000000000000
pred: ............................................................
  AA: AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK
             250       260       270       280       290       300

conf: 0000000000002
pred: .............
  AA: LTLNAKSIRCCLH
             310

Asterisks (*) represent disorder predictions and dots (.) 
prediction of order. The confidence estimates give a rough
indication of the probability that each residue is disordered.

POODLE

Aspa disopred.png


POS 1    M      T      S      C      H      I      A      E      E      H      I      
         -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
         0.461  0.444  0.413  0.401  0.418  0.461  0.537  0.644  0.693  0.62   0.468  


POS 12    Q      K      V      A      I      F      G      G      T      H      G      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.321  0.238  0.177  0.146  0.128  0.116  0.106  0.104  0.111  0.126  0.132  


POS 23    N      E      L      T      G      V      F      L      V      K      H      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.131  0.118  0.098  0.073  0.053  0.041  0.036  0.035  0.035  0.036  0.036  


POS 34    W      L      E      N      G      A      E      I      Q      R      T      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.038  0.045  0.06   0.081  0.099  0.119  0.133  0.146  0.147  0.143  0.129  


POS 45    G      L      E      V      K      P      F      I      T      N      P      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.111  0.09   0.073  0.062  0.054  0.047  0.039  0.033  0.033  0.037  0.041  


POS 56    R      A      V      K      K      C      T      R      Y      I      D      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.043  0.047  0.054  0.062  0.068  0.071  0.073  0.07   0.067  0.069  0.075  


POS 67    C      D      L      N      R      I      F      D      L      E      N      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.08   0.081  0.078  0.075  0.073  0.072  0.076  0.094  0.127  0.176  0.249  


POS 78    L      G      K      K      M      S      E      D      L      P      Y      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.403  0.554  0.737  0.766  0.804  0.755  0.682  0.65   0.632  0.636  0.583  


POS 89    E      V      R      R      A      Q      E      I      N      H      L      
          -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
          0.505  0.448  0.348  0.262  0.201  0.16   0.131  0.11   0.103  0.104  0.111  


POS 100    F      G      P      K      D      S      E      D      S      Y      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.116  0.117  0.108  0.089  0.067  0.049  0.039  0.034  0.033  0.035  


POS 110    D      I      I      F      D      L      H      N      T      T      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.038  0.041  0.043  0.043  0.042  0.041  0.042  0.045  0.052  0.06   


POS 120    S      N      M      G      C      T      L      I      L      E      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.07   0.081  0.092  0.101  0.109  0.111  0.107  0.096  0.085  0.072  


POS 130    D      S      R      N      N      F      L      I      Q      M      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.06   0.051  0.046  0.04   0.036  0.033  0.032  0.031  0.031  0.031  


POS 140    F      H      Y      I      K      T      S      L      A      P      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.033  0.036  0.04   0.043  0.046  0.049  0.05   0.053  0.055  0.059  


POS 150    L      P      C      Y      V      Y      L      I      E      H      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.065  0.073  0.088  0.103  0.115  0.119  0.118  0.111  0.104  0.104  


POS 160    P      S      L      K      Y      A      T      T      R      S      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.121  0.147  0.19   0.229  0.264  0.263  0.245  0.196  0.149  0.098  


POS 170    I      A      K      Y      P      V      G      I      E      V      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.069  0.053  0.051  0.057  0.066  0.08   0.093  0.102  0.103  0.099  


POS 180    G      P      Q      P      Q      G      V      L      R      A      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.096  0.094  0.095  0.095  0.099  0.098  0.099  0.095  0.094  0.086  


POS 190    D      I      L      D      Q      M      R      K      M      I      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.074  0.059  0.048  0.04   0.038  0.038  0.038  0.039  0.04   0.043  


POS 200    K      H      A      L      D      F      I      H      H      F      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.046  0.049  0.051  0.052  0.056  0.064  0.077  0.092  0.112  0.142  


POS 210    N      E      G      K      E      F      P      P      C      A      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.17   0.198  0.21   0.311  0.281  0.248  0.105  0.084  0.072  0.071  


POS 220    I      E      V      Y      K      I      I      E      K      V      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.069  0.065  0.06   0.056  0.052  0.054  0.062  0.076  0.105  0.141  


POS 230    D      Y      P      R      D      E      N      G      E      I      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.176  0.203  0.224  0.227  0.217  0.209  0.228  0.248  0.271  0.282  


POS 240    A      A      I      I      H      P      N      L      Q      D      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.289  0.269  0.24   0.208  0.188  0.169  0.155  0.152  0.167  0.193  


POS 250    Q      D      W      K      P      L      H      P      G      D      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.222  0.236  0.235  0.21   0.175  0.136  0.11   0.097  0.099  0.104  


POS 260    P      M      F      L      T      L      D      G      K      T      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.107  0.108  0.104  0.095  0.084  0.077  0.073  0.082  0.102  0.125  


POS 270    I      P      L      G      G      D      C      T      V      Y      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.144  0.162  0.169  0.166  0.156  0.149  0.133  0.117  0.099  0.089  


POS 280    P      V      F      V      N      E      A      A      Y      Y      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.077  0.072  0.067  0.064  0.066  0.082  0.122  0.184  0.241  0.279  


POS 290    E      K      K      E      A      F      A      K      T      T      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.282  0.264  0.236  0.229  0.238  0.257  0.263  0.252  0.231  0.222  


POS 300    K      L      T      L      N      A      K      S      I      R      
           -1     -1     -1     -1     -1     -1     -1     -1     -1     -1     
           0.246  0.278  0.305  0.31   0.303  0.277  0.263  0.371  0.382  0.38   


POS 310    C      C      L      H      
           -1     -1     -1     -1     
           0.348  0.51   0.496  0.489  

IUPRED

Long Disorder

Aspa iupred1.png

POS 1    M      T      S      C      H      I      A      E      E      H      I      
         0.3215  0.3426  0.2817  0.2783  0.2064  0.1275  0.1554  0.1823  0.2094  0.2364  0.2575  


POS 12    Q      K      V      A      I      F      G      G      T      H      G      
          0.2988  0.3087  0.2364  0.3215  0.3149  0.3321  0.2609  0.1823  0.1275  0.1206  0.1759  


POS 23    N      E      L      T      G      V      F      L      V      K      H      
          0.1028  0.0676  0.1070  0.1298  0.1881  0.2575  0.2715  0.1969  0.2034  0.2034  0.2064  


POS 34    W      L      E      N      G      A      E      I      Q      R      T      
          0.1942  0.1206  0.1914  0.1399  0.1373  0.2064  0.2002  0.1969  0.2541  0.2715  0.2951  


POS 45    G      L      E      V      K      P      F      I      T      N      P      
          0.3840  0.4256  0.3460  0.3321  0.3286  0.2609  0.2503  0.3249  0.2292  0.1583  0.1611  


POS 56    R      A      V      K      K      C      T      R      Y      I      D      
          0.0985  0.1554  0.0929  0.1373  0.1424  0.0765  0.0749  0.1229  0.0749  0.0780  0.0719  


POS 67    C      D      L      N      R      I      F      D      L      E      N      
          0.0424  0.0506  0.0734  0.0734  0.0605  0.1048  0.1115  0.1184  0.1229  0.2064  0.1323  


POS 78    L      G      K      K      M      S      E      D      L      P      Y      
          0.2258  0.1643  0.2364  0.2292  0.2002  0.2884  0.4087  0.3215  0.4119  0.3948  0.3053  


POS 89    E      V      R      R      A      Q      E      I      N      H      L      
          0.2849  0.2849  0.3149  0.3182  0.3631  0.3667  0.3667  0.3631  0.4441  0.3286  0.4220  


POS 100    F      G      P      K      D      S      E      D      S      Y      
           0.3215  0.3053  0.1969  0.2034  0.1611  0.1501  0.1476  0.2224  0.2164  0.2164  


POS 110    D      I      I      F      D      L      H      N      T      T      
           0.3053  0.3704  0.3704  0.2609  0.2680  0.1823  0.1184  0.0662  0.0690  0.0734  


POS 120    S      N      M      G      C      T      L      I      L      E      
           0.1229  0.1184  0.1914  0.2817  0.2849  0.2034  0.2064  0.2193  0.1759  0.0985  


POS 130    D      S      R      N      N      F      L      I      Q      M      
           0.0948  0.0581  0.0327  0.0398  0.0414  0.0719  0.0414  0.0581  0.1092  0.1092  


POS 140    F      H      Y      I      K      T      S      L      A      P      
           0.1162  0.0662  0.0398  0.0269  0.0163  0.0105  0.0115  0.0184  0.0275  0.0300  


POS 150    L      P      C      Y      V      Y      L      I      E      H      
           0.0372  0.0433  0.0424  0.0405  0.0581  0.0618  0.0618  0.0618  0.1007  0.0749  


POS 160    P      S      L      K      Y      A      T      T      R      S      
           0.0543  0.0870  0.0443  0.0888  0.1007  0.1424  0.1449  0.2292  0.2470  0.2328  


POS 170    I      A      K      Y      P      V      G      I      E      V      
           0.2575  0.2503  0.2752  0.3667  0.3704  0.3948  0.3426  0.3356  0.3019  0.3149  


POS 180    G      P      Q      P      Q      G      V      L      R      A      
           0.2328  0.2328  0.2752  0.2951  0.3321  0.3087  0.3631  0.3182  0.3182  0.2918  


POS 190    D      I      L      D      Q      M      R      K      M      I      
           0.3494  0.3182  0.2164  0.2129  0.1115  0.0605  0.0592  0.0870  0.0734  0.0780  


POS 200    K      H      A      L      D      F      I      H      H      F      
           0.1048  0.0967  0.1501  0.2364  0.1349  0.1399  0.1942  0.1206  0.1048  0.0817  


POS 210    N      E      G      K      E      F      P      P      C      A      
           0.1449  0.1048  0.0618  0.0734  0.0704  0.0389  0.0835  0.1349  0.0948  0.1028  


POS 220    I      E      V      Y      K      I      I      E      K      V      
           0.1115  0.1184  0.1092  0.1184  0.1323  0.1275  0.2129  0.2094  0.1229  0.1731  


POS 230    D      Y      P      R      D      E      N      G      E      I      
           0.1731  0.1759  0.1028  0.1476  0.2470  0.2609  0.2680  0.3631  0.3566  0.3740  


POS 240    A      A      I      I      H      P      N      L      Q      D      
           0.4476  0.3392  0.4256  0.4256  0.3460  0.3356  0.3392  0.3249  0.3392  0.3460  


POS 250    Q      D      W      K      P      L      H      P      G      D      
           0.3910  0.3215  0.2783  0.3631  0.3667  0.3774  0.3566  0.3392  0.4220  0.3321  


POS 260    P      M      F      L      T      L      D      G      K      T      
           0.3426  0.2541  0.2436  0.3426  0.3566  0.2470  0.3286  0.2680  0.1643  0.1852  


POS 270    I      P      L      G      G      D      C      T      V      Y      
           0.1298  0.0631  0.0543  0.1048  0.1731  0.1449  0.1881  0.1115  0.0646  0.0734  


POS 280    P      V      F      V      N      E      A      A      Y      Y      
           0.0690  0.1092  0.1048  0.1399  0.0765  0.0646  0.0581  0.1028  0.1007  0.1373  


POS 290    E      K      K      E      A      F      A      K      T      T      
           0.1449  0.1298  0.1184  0.2034  0.2364  0.2164  0.2002  0.1583  0.1823  0.1852  


POS 300    K      L      T      L      N      A      K      S      I      R      
           0.1881  0.1184  0.1184  0.1184  0.0888  0.0851  0.1349  0.1349  0.1137  0.0870 


POS 310    C      C      L      H      
           0.0631  0.0473  0.0734  0.0483  

Short Disorder

Aspa iupred2.png

POS 1    M      T      S      C      H      I      A      E      E      H      I      
         0.8886  0.7772  0.7418  0.6984  0.5992  0.5296  0.4149  0.2748  0.2333  0.1921  0.1566  


POS 12    Q      K      V      A      I      F      G      G      T      H      G      
          0.1805  0.1844  0.1732  0.2700  0.1766  0.2531  0.2913  0.2080  0.1292  0.0832  0.0965  


POS 23    N      E      L      T      G      V      F      L      V      K      H      
          0.0909  0.0991  0.0935  0.0660  0.1088  0.1766  0.1766  0.1495  0.1566  0.0991  0.1041  


POS 34    W      L      E      N      G      A      E      I      Q      R      T      
          0.1041  0.0909  0.1456  0.0935  0.0935  0.0909  0.1416  0.2385  0.2080  0.1416  0.1322  


POS 45    G      L      E      V      K      P      F      I      T      N      P      
          0.1844  0.2963  0.2820  0.2558  0.1921  0.2167  0.2041  0.1998  0.1921  0.1921  0.1380  


POS 56    R      A      V      K      K      C      T      R      Y      I      D      
          0.0935  0.1495  0.0935  0.1416  0.0935  0.0771  0.1322  0.1416  0.0935  0.0965  0.0464  


POS 67    C      D      L      N      R      I      F      D      L      E      N      
          0.0490  0.0567  0.0542  0.0554  0.0567  0.0935  0.0813  0.0858  0.1292  0.1958  0.1322  


POS 78    L      G      K      K      M      S      E      D      L      P      Y      
          0.2385  0.1732  0.2558  0.1958  0.1878  0.2432  0.2963  0.3184  0.4149  0.3359  0.3399  


POS 89    E      V      R      R      A      Q      E      I      N      H      L      
          0.4116  0.3491  0.2820  0.2913  0.3535  0.3399  0.3456  0.3399  0.4333  0.4078  0.4825  


POS 100    F      G      P      K      D      S      E      D      S      Y      
           0.3992  0.4651  0.4149  0.3578  0.3005  0.2820  0.1878  0.2483  0.2385  0.2385  


POS 110    D      I      I      F      D      L      H      N      T      T      
           0.2963  0.3668  0.3630  0.2865  0.2963  0.2209  0.2122  0.1292  0.0789  0.0441  


POS 120    S      N      M      G      C      T      L      I      L      E      
           0.0771  0.0771  0.1117  0.1635  0.2333  0.2209  0.1878  0.1292  0.0771  0.0858  


POS 130    D      S      R      N      N      F      L      I      Q      M      
           0.0660  0.0336  0.0316  0.0226  0.0102  0.0179  0.0179  0.0327  0.0279  0.0363  


POS 140    F      H      Y      I      K      T      S      L      A      P      
           0.0387  0.0173  0.0218  0.0128  0.0078  0.0044  0.0055  0.0059  0.0055  0.0055  


POS 150    L      P      C      Y      V      Y      L      I      E      H      
           0.0070  0.0167  0.0194  0.0200  0.0387  0.0212  0.0160  0.0157  0.0327  0.0455  


POS 160    P      S      L      K      Y      A      T      T      R      S      
           0.0387  0.0414  0.0279  0.0441  0.0455  0.0884  0.0991  0.1602  0.1635  0.1602  


POS 170    I      A      K      Y      P      V      G      I      E      V      
           0.1088  0.0965  0.1150  0.1878  0.2167  0.3146  0.3535  0.2865  0.2080  0.2080  


POS 180    G      P      Q      P      Q      G      V      L      R      A      
           0.1766  0.2748  0.2333  0.1667  0.2531  0.2385  0.2748  0.2748  0.3630  0.3184  


POS 190    D      I      L      D      Q      M      R      K      M      I      
           0.3146  0.3096  0.2748  0.2292  0.1292  0.1292  0.0744  0.0701  0.1150  0.1117  


POS 200    K      H      A      L      D      F      I      H      H      F      
           0.0723  0.0701  0.1150  0.1732  0.1602  0.1602  0.1205  0.1456  0.1766  0.1532  


POS 210    N      E      G      K      E      F      P      P      C      A      
           0.1958  0.1322  0.1416  0.1178  0.1205  0.1088  0.1205  0.1240  0.1380  0.1322  


POS 220    I      E      V      Y      K      I      I      E      K      V      
           0.1566  0.1698  0.1060  0.1266  0.1178  0.1240  0.2080  0.1766  0.1566  0.2292  


POS 230    D      Y      P      R      D      E      N      G      E      I      
           0.1878  0.2432  0.2041  0.2041  0.2122  0.2122  0.3225  0.3992  0.3005  0.3359  


POS 240    A      A      I      I      H      P      N      L      Q      D      
           0.4149  0.4245  0.5173  0.4078  0.4116  0.4245  0.3359  0.3263  0.3578  0.3399  


POS 250    Q      D      W      K      P      L      H      P      G      D      
           0.4282  0.4825  0.4703  0.4651  0.4600  0.4600  0.3399  0.3578  0.4333  0.4078  


POS 260    P      M      F      L      T      L      D      G      K      T      
           0.3885  0.2913  0.3053  0.3096  0.3184  0.2820  0.3630  0.3005  0.2657  0.1998  


POS 270    I      P      L      G      G      D      C      T      V      Y      
           0.1205  0.1205  0.1041  0.1018  0.1117  0.1150  0.1844  0.1380  0.1117  0.0701  


POS 280    P      V      F      V      N      E      A      A      Y      Y      
           0.0425  0.0744  0.0567  0.0909  0.0965  0.0744  0.0387  0.0464  0.0441  0.0607  


POS 290    E      K      K      E      A      F      A      K      T      T      
           0.0991  0.0771  0.0660  0.1041  0.0935  0.0935  0.0660  0.0832  0.1041  0.1041  


POS 300    K      L      T      L      N      A      K      S      I      R      
           0.1698  0.1041  0.0660  0.0441  0.0405  0.0701  0.1602  0.2333  0.2865  0.3456  


POS 310    C      C      L      H      
           0.4037  0.4556  0.5802  0.6334  


Structured Regions

Aspa iupred3.png

IUPRED predicts one domain comprising of the whole input sequence.



Meta-Disorder

Number Residue NORSnet NORS2st PROFbval bval2st Ucon Ucon2st MD_raw   MD_rel  MD2st 
    1	M	0.33	-	0.99	D	0.17	-	0.551	1	D
    2	T	0.26	-	0.78	D	0.25	-	0.531	0	D
    3	S	0.16	-	0.72	D	0.35	-	0.535	0	D
    4	C	0.23	-	0.65	D	0.33	-	0.505	0	-
    5	H	0.20	-	0.48	D	0.25	-	0.475	1	-
    6	I	0.16	-	0.55	D	0.30	-	0.465	1	-
    7	A	0.34	-	0.56	D	0.40	-	0.444	2	-
    8	E	0.28	-	0.67	D	0.30	-	0.424	3	-
    9	E	0.21	-	0.73	D	0.38	-	0.404	3	-
   10	H	0.15	-	0.70	D	0.30	-	0.374	4	-
   11	I	0.15	-	0.59	D	0.29	-	0.354	5	-
   12	Q	0.15	-	0.60	D	0.28	-	0.313	6	-
   13	K	0.14	-	0.51	D	0.23	-	0.263	8	-
   14	V	0.14	-	0.30	-	0.19	-	0.253	8	-
   15	A	0.16	-	0.24	-	0.19	-	0.250	9	-
   16	I	0.13	-	0.20	-	0.24	-	0.242	9	-
   17	F	0.10	-	0.13	-	0.23	-	0.250	9	-
   18	G	0.13	-	0.18	-	0.21	-	0.242	9	-
   19	G	0.10	-	0.24	-	0.20	-	0.253	8	-
   20	T	0.07	-	0.34	-	0.20	-	0.253	8	-
   21	H	0.06	-	0.26	-	0.26	-	0.260	8	-
   22	G	0.06	-	0.39	-	0.29	-	0.253	8	-
   23	N	0.06	-	0.48	D	0.22	-	0.250	9	-
   24	E	0.06	-	0.47	D	0.18	-	0.242	9	-
   25	L	0.11	-	0.43	-	0.16	-	0.242	9	-
   26	T	0.12	-	0.39	-	0.20	-	0.253	8	-
   27	G	0.10	-	0.32	-	0.20	-	0.242	9	-
   28	V	0.08	-	0.28	-	0.15	-	0.242	9	-
   29	F	0.12	-	0.35	-	0.13	-	0.242	9	-
   30	L	0.14	-	0.28	-	0.15	-	0.242	9	-
   31	V	0.09	-	0.30	-	0.16	-	0.253	8	-
   32	K	0.07	-	0.40	-	0.16	-	0.263	8	-
   33	H	0.06	-	0.40	-	0.18	-	0.293	7	-
   34	W	0.08	-	0.38	-	0.29	-	0.273	8	-
   35	L	0.09	-	0.45	-	0.30	-	0.283	7	-
   36	E	0.09	-	0.56	D	0.41	-	0.313	6	-
   37	N	0.12	-	0.62	D	0.32	-	0.313	6	-
   38	G	0.16	-	0.62	D	0.35	-	0.330	6	-
   39	A	0.11	-	0.64	D	0.46	-	0.313	6	-
   40	E	0.10	-	0.66	D	0.47	-	0.323	6	-
   41	I	0.09	-	0.65	D	0.47	-	0.323	6	-
   42	Q	0.10	-	0.64	D	0.36	-	0.293	7	-
   43	R	0.09	-	0.61	D	0.50	-	0.273	8	-
   44	T	0.08	-	0.61	D	0.56	-	0.273	8	-
   45	G	0.08	-	0.53	D	0.34	-	0.263	8	-
   46	L	0.09	-	0.43	-	0.35	-	0.260	8	-
   47	E	0.10	-	0.33	-	0.32	-	0.253	8	-
   48	V	0.07	-	0.23	-	0.32	-	0.250	9	-
   49	K	0.06	-	0.17	-	0.34	-	0.253	8	-
   50	P	0.08	-	0.18	-	0.37	-	0.263	8	-
   51	F	0.08	-	0.17	-	0.49	-	0.273	8	-
   52	I	0.07	-	0.21	-	0.33	-	0.273	8	-
   53	T	0.06	-	0.28	-	0.53	-	0.303	7	-
   54	N	0.07	-	0.28	-	0.53	-	0.303	7	-
   55	P	0.09	-	0.36	-	0.37	-	0.313	6	-
   56	R	0.08	-	0.41	-	0.51	-	0.313	6	-
   57	A	0.10	-	0.40	-	0.66	D	0.280	7	-
   58	V	0.13	-	0.40	-	0.51	-	0.263	8	-
   59	K	0.16	-	0.48	D	0.37	-	0.263	8	-
   60	K	0.19	-	0.47	D	0.40	-	0.263	8	-
   61	C	0.18	-	0.47	D	0.29	-	0.253	8	-
   62	T	0.16	-	0.55	D	0.35	-	0.263	8	-
   63	R	0.18	-	0.51	D	0.31	-	0.253	8	-
   64	Y	0.22	-	0.47	D	0.25	-	0.273	8	-
   65	I	0.23	-	0.47	D	0.20	-	0.260	8	-
   66	D	0.23	-	0.56	D	0.21	-	0.263	8	-
   67	C	0.25	-	0.57	D	0.16	-	0.263	8	-
   68	D	0.30	-	0.43	-	0.18	-	0.263	8	-
   69	L	0.29	-	0.40	-	0.18	-	0.260	8	-
   70	N	0.28	-	0.40	-	0.25	-	0.263	8	-
   71	R	0.40	-	0.39	-	0.23	-	0.273	8	-
   72	I	0.46	-	0.43	-	0.22	-	0.280	7	-
   73	F	0.46	-	0.37	-	0.19	-	0.273	8	-
   74	D	0.37	-	0.46	-	0.32	-	0.310	6	-
   75	L	0.33	-	0.57	D	0.40	-	0.390	4	-
   76	E	0.36	-	0.61	D	0.30	-	0.444	2	-
   77	N	0.44	-	0.62	D	0.41	-	0.465	1	-
   78	L	0.38	-	0.66	D	0.65	D	0.531	0	D
   79	G	0.30	-	0.70	D	0.64	D	0.485	1	-
   80	K	0.35	-	0.69	D	0.64	D	0.515	0	-
   81	K	0.23	-	0.69	D	0.59	D	0.475	1	-
   82	M	0.23	-	0.66	D	0.42	-	0.444	2	-
   83	S	0.28	-	0.69	D	0.64	D	0.449	2	-
   84	E	0.34	-	0.72	D	0.56	-	0.485	1	-
   85	D	0.29	-	0.74	D	0.45	-	0.424	3	-
   86	L	0.20	-	0.64	D	0.35	-	0.424	3	-
   87	P	0.20	-	0.64	D	0.45	-	0.404	3	-
   88	Y	0.17	-	0.55	D	0.46	-	0.384	4	-
   89	E	0.14	-	0.50	D	0.46	-	0.364	5	-
   90	V	0.13	-	0.45	-	0.30	-	0.333	6	-
   91	R	0.12	-	0.43	-	0.43	-	0.320	6	-
   92	R	0.11	-	0.40	-	0.36	-	0.293	7	-
   93	A	0.11	-	0.34	-	0.36	-	0.283	7	-
   94	Q	0.10	-	0.45	-	0.22	-	0.290	7	-
   95	E	0.12	-	0.41	-	0.25	-	0.303	7	-
   96	I	0.09	-	0.34	-	0.26	-	0.283	7	-
   97	N	0.11	-	0.40	-	0.33	-	0.313	6	-
   98	H	0.10	-	0.49	D	0.39	-	0.313	6	-
   99	L	0.10	-	0.47	D	0.38	-	0.313	6	-
  100	F	0.13	-	0.47	D	0.38	-	0.293	7	-
  101	G	0.14	-	0.54	D	0.58	D	0.323	6	-
  102	P	0.13	-	0.61	D	0.58	D	0.333	6	-
  103	K	0.13	-	0.60	D	0.47	-	0.323	6	-
  104	D	0.11	-	0.61	D	0.71	D	0.323	6	-
  105	S	0.10	-	0.65	D	0.73	D	0.283	7	-
  106	E	0.10	-	0.70	D	0.62	D	0.283	7	-
  107	D	0.12	-	0.70	D	0.42	-	0.273	8	-
  108	S	0.11	-	0.64	D	0.37	-	0.270	8	-
  109	Y	0.12	-	0.50	D	0.23	-	0.253	8	-
  110	D	0.13	-	0.39	-	0.20	-	0.242	9	-
  111	I	0.16	-	0.29	-	0.18	-	0.240	9	-
  112	I	0.15	-	0.20	-	0.16	-	0.240	9	-
  113	F	0.14	-	0.20	-	0.16	-	0.240	9	-
  114	D	0.17	-	0.21	-	0.20	-	0.242	9	-
  115	L	0.21	-	0.20	-	0.19	-	0.253	8	-
  116	H	0.17	-	0.28	-	0.19	-	0.273	8	-
  117	N	0.11	-	0.48	D	0.23	-	0.283	7	-
  118	T	0.13	-	0.39	-	0.24	-	0.283	7	-
  119	T	0.13	-	0.41	-	0.21	-	0.273	8	-
  120	S	0.15	-	0.46	-	0.21	-	0.273	8	-
  121	N	0.22	-	0.54	D	0.18	-	0.263	8	-
  122	M	0.25	-	0.51	D	0.14	-	0.260	8	-
  123	G	0.30	-	0.51	D	0.16	-	0.253	8	-
  124	C	0.26	-	0.42	-	0.18	-	0.250	9	-
  125	T	0.29	-	0.40	-	0.18	-	0.242	9	-
  126	L	0.24	-	0.34	-	0.18	-	0.253	8	-
  127	I	0.17	-	0.28	-	0.23	-	0.260	8	-
  128	L	0.13	-	0.28	-	0.25	-	0.263	8	-
  129	E	0.14	-	0.41	-	0.24	-	0.253	8	-
  130	D	0.14	-	0.54	D	0.18	-	0.253	8	-
  131	S	0.10	-	0.59	D	0.19	-	0.273	8	-
  132	R	0.07	-	0.68	D	0.27	-	0.280	7	-
  133	N	0.05	-	0.64	D	0.28	-	0.273	8	-
  134	N	0.06	-	0.61	D	0.18	-	0.273	8	-
  135	F	0.07	-	0.53	D	0.15	-	0.260	8	-
  136	L	0.08	-	0.47	D	0.13	-	0.242	9	-
  137	I	0.10	-	0.47	D	0.13	-	0.242	9	-
  138	Q	0.16	-	0.42	-	0.13	-	0.242	9	-
  139	M	0.15	-	0.34	-	0.13	-	0.242	9	-
  140	F	0.11	-	0.32	-	0.14	-	0.250	9	-
  141	H	0.13	-	0.41	-	0.14	-	0.263	8	-
  142	Y	0.16	-	0.36	-	0.16	-	0.263	8	-
  143	I	0.12	-	0.34	-	0.16	-	0.263	8	-
  144	K	0.11	-	0.46	-	0.15	-	0.283	7	-
  145	T	0.07	-	0.54	D	0.20	-	0.273	8	-
  146	S	0.07	-	0.55	D	0.17	-	0.253	8	-
  147	L	0.09	-	0.56	D	0.17	-	0.242	9	-
  148	A	0.10	-	0.57	D	0.17	-	0.250	9	-
  149	P	0.09	-	0.60	D	0.13	-	0.253	8	-
  150	L	0.11	-	0.51	D	0.13	-	0.242	9	-
  151	P	0.13	-	0.44	-	0.14	-	0.242	9	-
  152	C	0.12	-	0.38	-	0.13	-	0.240	9	-
  153	Y	0.13	-	0.31	-	0.13	-	0.240	9	-
  154	V	0.18	-	0.28	-	0.13	-	0.242	9	-
  155	Y	0.17	-	0.33	-	0.14	-	0.250	9	-
  156	L	0.21	-	0.47	D	0.13	-	0.253	8	-
  157	I	0.22	-	0.54	D	0.15	-	0.263	8	-
  158	E	0.17	-	0.58	D	0.15	-	0.283	7	-
  159	H	0.16	-	0.62	D	0.17	-	0.303	7	-
  160	P	0.13	-	0.65	D	0.21	-	0.323	6	-
  161	S	0.14	-	0.59	D	0.29	-	0.303	7	-
  162	L	0.17	-	0.58	D	0.41	-	0.303	7	-
  163	K	0.21	-	0.56	D	0.36	-	0.293	7	-
  164	Y	0.32	-	0.51	D	0.29	-	0.273	8	-
  165	A	0.31	-	0.47	D	0.26	-	0.273	8	-
  166	T	0.28	-	0.45	-	0.32	-	0.273	8	-
  167	T	0.22	-	0.41	-	0.33	-	0.273	8	-
  168	R	0.15	-	0.47	D	0.26	-	0.273	8	-
  169	S	0.14	-	0.47	D	0.28	-	0.280	7	-
  170	I	0.12	-	0.46	-	0.29	-	0.273	8	-
  171	A	0.12	-	0.47	D	0.22	-	0.283	7	-
  172	K	0.11	-	0.58	D	0.27	-	0.290	7	-
  173	Y	0.13	-	0.47	D	0.20	-	0.263	8	-
  174	P	0.11	-	0.38	-	0.19	-	0.253	8	-
  175	V	0.10	-	0.26	-	0.26	-	0.250	9	-
  176	G	0.09	-	0.24	-	0.31	-	0.250	9	-
  177	I	0.13	-	0.33	-	0.25	-	0.250	9	-
  178	E	0.20	-	0.28	-	0.37	-	0.253	8	-
  179	V	0.26	-	0.41	-	0.33	-	0.253	8	-
  180	G	0.20	-	0.45	-	0.33	-	0.270	8	-
  181	P	0.17	-	0.59	D	0.25	-	0.283	7	-
  182	Q	0.12	-	0.49	D	0.35	-	0.283	7	-
  183	P	0.12	-	0.51	D	0.28	-	0.273	8	-
  184	Q	0.13	-	0.54	D	0.42	-	0.273	8	-
  185	G	0.10	-	0.51	D	0.33	-	0.263	8	-
  186	V	0.12	-	0.55	D	0.22	-	0.253	8	-
  187	L	0.17	-	0.54	D	0.24	-	0.253	8	-
  188	R	0.14	-	0.48	D	0.24	-	0.263	8	-
  189	A	0.11	-	0.53	D	0.18	-	0.273	8	-
  190	D	0.11	-	0.51	D	0.19	-	0.273	8	-
  191	I	0.08	-	0.41	-	0.31	-	0.283	7	-
  192	L	0.07	-	0.42	-	0.33	-	0.263	8	-
  193	D	0.06	-	0.47	D	0.24	-	0.273	8	-
  194	Q	0.08	-	0.45	-	0.33	-	0.270	8	-
  195	M	0.04	-	0.34	-	0.26	-	0.263	8	-
  196	R	0.04	-	0.43	-	0.34	-	0.273	8	-
  197	K	0.05	-	0.44	-	0.34	-	0.263	8	-
  198	M	0.06	-	0.29	-	0.34	-	0.263	8	-
  199	I	0.06	-	0.28	-	0.22	-	0.253	8	-
  200	K	0.07	-	0.34	-	0.22	-	0.263	8	-
  201	H	0.07	-	0.32	-	0.20	-	0.253	8	-
  202	A	0.08	-	0.28	-	0.15	-	0.250	9	-
  203	L	0.08	-	0.35	-	0.15	-	0.253	8	-
  204	D	0.09	-	0.43	-	0.19	-	0.263	8	-
  205	F	0.11	-	0.41	-	0.18	-	0.263	8	-
  206	I	0.12	-	0.45	-	0.18	-	0.253	8	-
  207	H	0.15	-	0.59	D	0.23	-	0.270	8	-
  208	H	0.18	-	0.59	D	0.40	-	0.290	7	-
  209	F	0.22	-	0.58	D	0.24	-	0.283	7	-
  210	N	0.27	-	0.63	D	0.37	-	0.293	7	-
  211	E	0.27	-	0.66	D	0.53	-	0.313	6	-
  212	G	0.28	-	0.68	D	0.44	-	0.313	6	-
  213	K	0.26	-	0.70	D	0.46	-	0.323	6	-
  214	E	0.26	-	0.71	D	0.50	-	0.323	6	-
  215	F	0.20	-	0.70	D	0.56	-	0.303	7	-
  216	P	0.21	-	0.69	D	0.37	-	0.293	7	-
  217	P	0.24	-	0.69	D	0.28	-	0.280	7	-
  218	C	0.14	-	0.66	D	0.28	-	0.263	8	-
  219	A	0.14	-	0.58	D	0.19	-	0.263	8	-
  220	I	0.15	-	0.52	D	0.19	-	0.263	8	-
  221	E	0.11	-	0.47	D	0.22	-	0.270	8	-
  222	V	0.11	-	0.34	-	0.26	-	0.273	8	-
  223	Y	0.12	-	0.30	-	0.28	-	0.280	7	-
  224	K	0.08	-	0.37	-	0.34	-	0.280	7	-
  225	I	0.09	-	0.32	-	0.33	-	0.273	8	-
  226	I	0.07	-	0.35	-	0.29	-	0.283	7	-
  227	E	0.09	-	0.43	-	0.38	-	0.313	6	-
  228	K	0.09	-	0.49	D	0.61	D	0.333	6	-
  229	V	0.12	-	0.49	D	0.58	D	0.337	6	-
  230	D	0.16	-	0.53	D	0.75	D	0.354	5	-
  231	Y	0.14	-	0.52	D	0.84	D	0.343	5	-
  232	P	0.12	-	0.57	D	0.84	D	0.313	6	-
  233	R	0.13	-	0.66	D	0.59	D	0.303	7	-
  234	D	0.15	-	0.69	D	0.70	D	0.310	6	-
  235	E	0.10	-	0.71	D	0.59	D	0.293	7	-
  236	N	0.12	-	0.71	D	0.62	D	0.303	7	-
  237	G	0.17	-	0.67	D	0.44	-	0.293	7	-
  238	E	0.22	-	0.60	D	0.40	-	0.283	7	-
  239	I	0.17	-	0.53	D	0.36	-	0.270	8	-
  240	A	0.16	-	0.38	-	0.30	-	0.260	8	-
  241	A	0.19	-	0.29	-	0.22	-	0.253	8	-
  242	I	0.16	-	0.28	-	0.24	-	0.263	8	-
  243	I	0.22	-	0.33	-	0.24	-	0.263	8	-
  244	H	0.25	-	0.34	-	0.34	-	0.293	7	-
  245	P	0.14	-	0.48	D	0.41	-	0.323	6	-
  246	N	0.16	-	0.53	D	0.30	-	0.343	5	-
  247	L	0.16	-	0.58	D	0.53	-	0.343	5	-
  248	Q	0.16	-	0.61	D	0.71	D	0.374	4	-
  249	D	0.22	-	0.64	D	0.59	D	0.354	5	-
  250	Q	0.30	-	0.64	D	0.51	-	0.364	5	-
  251	D	0.34	-	0.62	D	0.52	-	0.333	6	-
  252	W	0.33	-	0.52	D	0.65	D	0.313	6	-
  253	K	0.22	-	0.58	D	0.68	D	0.283	7	-
  254	P	0.21	-	0.58	D	0.63	D	0.283	7	-
  255	L	0.18	-	0.54	D	0.45	-	0.263	8	-
  256	H	0.16	-	0.68	D	0.27	-	0.263	8	-
  257	P	0.18	-	0.69	D	0.28	-	0.273	8	-
  258	G	0.19	-	0.57	D	0.21	-	0.270	8	-
  259	D	0.28	-	0.54	D	0.16	-	0.290	7	-
  260	P	0.25	-	0.54	D	0.23	-	0.270	8	-
  261	M	0.19	-	0.40	-	0.24	-	0.273	8	-
  262	F	0.16	-	0.34	-	0.29	-	0.253	8	-
  263	L	0.13	-	0.37	-	0.30	-	0.253	8	-
  264	T	0.10	-	0.46	-	0.20	-	0.242	9	-
  265	L	0.14	-	0.56	D	0.20	-	0.253	8	-
  266	D	0.13	-	0.61	D	0.20	-	0.263	8	-
  267	G	0.11	-	0.62	D	0.26	-	0.280	7	-
  268	K	0.10	-	0.60	D	0.34	-	0.283	7	-
  269	T	0.10	-	0.60	D	0.40	-	0.273	8	-
  270	I	0.08	-	0.46	-	0.41	-	0.250	9	-
  271	P	0.07	-	0.43	-	0.35	-	0.250	9	-
  272	L	0.12	-	0.46	-	0.29	-	0.242	9	-
  273	G	0.10	-	0.53	D	0.18	-	0.242	9	-
  274	G	0.08	-	0.52	D	0.19	-	0.250	9	-
  275	D	0.05	-	0.62	D	0.19	-	0.253	8	-
  276	C	0.06	-	0.68	D	0.15	-	0.263	8	-
  277	T	0.10	-	0.59	D	0.16	-	0.263	8	-
  278	V	0.08	-	0.52	D	0.17	-	0.263	8	-
  279	Y	0.09	-	0.33	-	0.20	-	0.242	9	-
  280	P	0.10	-	0.27	-	0.17	-	0.242	9	-
  281	V	0.12	-	0.23	-	0.21	-	0.242	9	-
  282	F	0.12	-	0.18	-	0.17	-	0.253	8	-
  283	V	0.09	-	0.24	-	0.16	-	0.263	8	-
  284	N	0.05	-	0.28	-	0.23	-	0.303	7	-
  285	E	0.06	-	0.39	-	0.28	-	0.384	4	-
  286	A	0.09	-	0.35	-	0.46	-	0.404	3	-
  287	A	0.08	-	0.43	-	0.72	D	0.418	3	-
  288	Y	0.08	-	0.37	-	0.79	D	0.374	4	-
  289	Y	0.09	-	0.55	D	0.61	D	0.354	5	-
  290	E	0.10	-	0.41	-	0.49	-	0.333	6	-
  291	K	0.10	-	0.50	D	0.65	D	0.323	6	-
  292	K	0.07	-	0.47	D	0.66	D	0.323	6	-
  293	E	0.07	-	0.36	-	0.79	D	0.333	6	-
  294	A	0.06	-	0.29	-	0.95	D	0.354	5	-
  295	F	0.08	-	0.27	-	0.82	D	0.333	6	-
  296	A	0.09	-	0.32	-	0.70	D	0.323	6	-
  297	K	0.09	-	0.42	-	0.41	-	0.343	5	-
  298	T	0.08	-	0.42	-	0.36	-	0.343	5	-
  299	T	0.10	-	0.51	D	0.36	-	0.414	3	-
  300	K	0.09	-	0.54	D	0.64	D	0.455	2	-
  301	L	0.09	-	0.48	D	0.70	D	0.394	4	-
  302	T	0.15	-	0.55	D	0.43	-	0.404	3	-
  303	L	0.15	-	0.48	D	0.46	-	0.374	4	-
  304	N	0.12	-	0.48	D	0.34	-	0.374	4	-
  305	A	0.13	-	0.47	D	0.19	-	0.374	4	-
  306	K	0.22	-	0.55	D	0.19	-	0.384	4	-
  307	S	0.07	-	0.53	D	0.18	-	0.434	2	-
  308	I	0.07	-	0.41	-	0.23	-	0.424	3	-
  309	R	0.07	-	0.37	-	0.21	-	0.414	3	-
  310	C	0.11	-	0.60	D	0.19	-	0.414	3	-
  311	C	0.14	-	0.67	D	0.14	-	0.394	4	-
  312	L	0.15	-	0.72	D	0.13	-	0.424	3	-
  313	H	0.44	-	0.80	D	0.13	-	0.485	1	-


Key for output
----------------
Number - residue number
Residue - amino-acid type
NORSnet - raw score by NORSnet (prediction of unstructured loops)
NORS2st - two-state prediction by NORSnet; D=disordered
PROFbval - raw score by PROFbval (prediction of residue flexibility from sequence)
Bval2st - two-state prediction by PROFbval
Ucon - raw score by Ucon (prediction of protein disorder using predicted internal contacts)
Ucon2st - two-state prediction by Ucon
MD - raw score by MD (prediction of protein disorder using orthogonal sources)
MD_rel - reliability of the prediction by MD; values range from 0-9. 9=strong prediction
MD2st - two-state prediction by MD

Prediction of transmembrane alpha-helices and signal peptides

TMHMM

Since the VM version could not be made to work, we used the server at http://www.cbs.dtu.dk/services/TMHMM/.

Sp P45381 ACY2 HUMAN.gif

# sp_P45381_ACY2_HUMAN Length: 313
# sp_P45381_ACY2_HUMAN Number of predicted TMHs:  0
# sp_P45381_ACY2_HUMAN Exp number of AAs in TMHs: 0.2005
# sp_P45381_ACY2_HUMAN Exp number, first 60 AAs:  0.01618
# sp_P45381_ACY2_HUMAN Total prob of N-in:        0.03827
sp_P45381_ACY2_HUMAN	TMHMM2.0	outside	     1   313

http://www.cbs.dtu.dk/services/TMHMM-2.0/TMHMM2.0.guide.html#output

Phobius & PolyPhobius

Aspa phobius.png

OCTOPUS & SPOCTOPUS

No transmembrane regions were predicted by both methods.

SignalP

HMM

ASPA Plot.hmm.1.gif

Neural Network

ASPA Plot.nn.1.gif

TargetP

### targetp v1.1 prediction results ##################################
Number of query sequences:  1
Cleavage site predictions not included.
Using NON-PLANT networks.

Name                  Len            mTP     SP  other  Loc  RC
----------------------------------------------------------------------
sp_P45381_ACY2_HUMAN  313          0.073  0.109  0.898   _    2
----------------------------------------------------------------------
cutoff                             0.000  0.000  0.000

http://www.cbs.dtu.dk/services/TargetP-1.1/output.php

Prediction of GO terms

GOPET

GOid Aspect Confidence GO Term
GO:0016787 F 96% hydrolase activity
GO:0004046 F 82% aminoacyclase activity
GO:0019807 F 82% aspartoacyclase activity
GO:0016788 F 81% hydrolase activity acting on ester bonds

Pfam

Aspa pfam significant.png

ProtFun 2.2

...