Difference between revisions of "Reference Sequence BCKDHA"
(→Sequence searches) |
(→Sequence searches) |
||
| Line 64: | Line 64: | ||
|- |
|- |
||
|gi|13277798|gb|AAH03787.1||95%||PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
|gi|13277798|gb|AAH03787.1||95%||PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
||
| + | |- |
||
| + | |gi|148727347|ref|NP_001092034.1||95%||BLAST |
||
| + | |- |
||
| + | |gi|196011048|ref|XP_002115388.1||66%||PSI BLAST, 3 iterations, E-value cutoff 0.005 |
||
| + | |- |
||
| + | |gi|149543950|ref|XP_001517857.1||67%||BLAST |
||
| + | |- |
||
| + | |gi|47227873|emb|CAG09036.1||82,5%||FASTA |
||
| + | |- |
||
| + | |gi|47196273|emb|CAF88112.1||81%||PSI BLAST, 5 iterations, E-value cutoff 0.005 |
||
| + | |- |
||
| + | |gi|12964598|dbj|BAB32665.1||88%||PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
||
| + | |- |
||
| + | |gi|193290664|gb|ACF17640.1||47%||BLAST |
||
| + | |- |
||
| + | |gi|215431443|ref|ZP_03429362.1||40%||FASTA |
||
| + | |- |
||
| + | |gi|225557347|gb|EEH05633.1||51%||PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
||
| + | |- |
||
| + | |gi|58267618|ref|XP_570965.1||50%||PSI BLAST, 5 iterations, E-value cutoff 0.005 |
||
| + | |- |
||
| + | |gi|162449842|ref|YP_001612209.1||41%||PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
||
| + | |- |
||
| + | |gi|56966700|pdb|1W85||31%||PSI BLAST, 3 iterations, E-value cutoff 0.005 |
||
| + | |- |
||
| + | |gi|5822330|pdb|1QS0||38.1%||FASTA |
||
| + | |- |
||
| + | |gi|13516864|dbj|BAB40585.1||33%||PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
||
| + | |- |
||
| + | |gi|284166853|ref|YP_003405132.1||35%||PSI BLAST, 5 iterations, E-value cutoff 0.005 |
||
| + | |- |
||
| + | |gi|76800932|ref|YP_325940.1||34%||PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
||
|} |
|} |
||
Revision as of 12:40, 19 May 2011
Sequence
- Uniprot:
>sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAE FIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY ESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYG NISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGA ASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDG NDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHP ISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQL RKQQESLARHLQTYGEHYPLDHFDK
Sequence info: [1] The Uniprot sequence is 445 aa long, as is contains the transit peptide sequence from position 1-45.
- PDB:
>1U5B:A|PDBID|CHAIN|SEQUENCE
SSLDDKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQ GRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTI SSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIA ARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLR HYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK
Sequence info: [2]
Sequence Alignments
Sequence searches
- FASTA
../bin/fasta36 sequence.fasta database > FastaOutput.txt
- BLAST
blastall -p blastp -d database -i sequence.fasta > BlastOutput.txt
- PSIBLAST
blastpgp -i sequence.fasta -j iterations -h evalueCutoff -d database > PsiblastOutput.txt
- HHSearch
hhsearch -i query -d database -o output.txt
database = /data/blast/nr/nr
Sequences chosen for the multiple Alignment:
| SeqIdentifier | Seq Identity | source |
|---|---|---|
| 99-90% Sequence Identity | ||
| 56967006|pdb|1X7Z | 99% | PSI BLAST, 3 iterations, E-value cutoff 0.005 |
| 7546384|pdb|1DTW | 95% | BLAST |
| 34810149|pdb|1OLU | 99% | PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
| 13277798|gb|AAH03787.1 | 95% | PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
| 148727347|ref|NP_001092034.1 | 95% | BLAST |
| 196011048|ref|XP_002115388.1 | 66% | PSI BLAST, 3 iterations, E-value cutoff 0.005 |
| 149543950|ref|XP_001517857.1 | 67% | BLAST |
| 47227873|emb|CAG09036.1 | 82,5% | FASTA |
| 47196273|emb|CAF88112.1 | 81% | PSI BLAST, 5 iterations, E-value cutoff 0.005 |
| 12964598|dbj|BAB32665.1 | 88% | PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
| 193290664|gb|ACF17640.1 | 47% | BLAST |
| 215431443|ref|ZP_03429362.1 | 40% | FASTA |
| 225557347|gb|EEH05633.1 | 51% | PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
| 58267618|ref|XP_570965.1 | 50% | PSI BLAST, 5 iterations, E-value cutoff 0.005 |
| 162449842|ref|YP_001612209.1 | 41% | PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
| 56966700|pdb|1W85 | 31% | PSI BLAST, 3 iterations, E-value cutoff 0.005 |
| 5822330|pdb|1QS0 | 38.1% | FASTA |
| 13516864|dbj|BAB40585.1 | 33% | PSI BLAST, 3 iterations, E-value cutoff 10E-6 |
| 284166853|ref|YP_003405132.1 | 35% | PSI BLAST, 5 iterations, E-value cutoff 0.005 |
| 76800932|ref|YP_325940.1 | 34% | PSI BLAST, 5 iterations, E-value cutoff 10E-6 |
Sequences for the Multiple Sequences Alignment were downloaded via NCBI, the sequence id can be changed in the link to retrieve the fasta format: http://www.ncbi.nlm.nih.gov/protein/76800932?report=fasta
back to Maple syrup urine disease main page
