Difference between revisions of "Task 2: Multiple Sequence Alignment"

From Bioinformatikpedia
(Dataset creation)
(Dataset creation)
Line 40: Line 40:
 
<tr><td>G3RDZ3</td><td>99%</td><td>Gorilla gorilla gorilla</td><td>G3RDZ3_GORGO Uncharacterized protein</td></tr>
 
<tr><td>G3RDZ3</td><td>99%</td><td>Gorilla gorilla gorilla</td><td>G3RDZ3_GORGO Uncharacterized protein</td></tr>
 
<tr><td>G7PXN6</td><td>92%</td><td>Macaca fascicularis</td><td>G7PXN6_MACFA Putative uncharacterized protein</td></tr>
 
<tr><td>G7PXN6</td><td>92%</td><td>Macaca fascicularis</td><td>G7PXN6_MACFA Putative uncharacterized protein</td></tr>
  +
<tr><td>C1BZX0</td><td>61%</td><td>Caligus clemensi</td><td>C1BZX0_9MAXI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial</td></tr>
  +
<tr><td>E9C2J8</td><td>62%</td><td>Capsaspora owczarzaki</td><td>E9C2J8_CAPO3 Branched chain keto acid dehydrogenase E1</td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
 
<tr><td colspan=4 align=center>moderate identity ( >40% )</td></tr>
 
<tr><td colspan=4 align=center>moderate identity ( >40% )</td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
 
<tr><td colspan=4 align=center>whole range identity ( 0-100% )</td></tr>
 
<tr><td colspan=4 align=center>whole range identity ( 0-100% )</td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
  +
<tr><td></td><td></td><td></td><td></td></tr>
 
</table>
 
</table>
   

Revision as of 12:49, 10 May 2012

Sorry, were behind scedule, page will be filled with content as soon as possible.


We researched the protein sequence of the branched-chain alpha-keto acid dehydrogenase complex subunit alpha (BCKDHA) with the following original sequence:

  • BCKDHA
>sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAE
FIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
ESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYG
NISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGA
ASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDG
NDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHP
ISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQL
RKQQESLARHLQTYGEHYPLDHFDK


Blast

To calculate the sequence alignments we used the blast and psiblast binaries from NCBI (version 2.2.26+) As the standard blast alignment hits the limit of 250 matches per alignment, and all of them still seemed very significant (Evalue of < 1e-60) we increased the number of max target hits to 2000 and set an Evalue threshold of 0.002. With this method we found about 1550 matching alignments.

As can be seen in the figure to the right

Distibution of sequence similarity with the BCKDHA blast-query against the big80 database.

, the sequence alignments mainly have a similarity between 15% and 40%.

Distribution of evalues in BLAST.

Psi-Blast

HHBlits

Multiple Sequence Alignment (MSA)

In this task we are to produce MSA´s out of our database search results. The first step here is to create representative datasets, followed by creating MSA´s using different tools, and finally review the alignments and compare the tool against each other.

Dataset creation

We have chosen the following sequences from the Psi-Blast run with evalue E-10 and 10 iterations, trying to fit into the scheme given on the task-page:

IdentifierIdentityOrganismDescription
ref seq
P12694100%humanODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
high identity ( >60% )
B4DP4790%humanB4DP47_HUMAN Uncharacterized protein
H2L9X980%Oryzias latipesH2L9X9_ORYLA Uncharacterized protein
H2NYX790%Pongo abeliiH2NYX7_PONAB Uncharacterized protein
G3RDZ399%Gorilla gorilla gorillaG3RDZ3_GORGO Uncharacterized protein
G7PXN692%Macaca fascicularisG7PXN6_MACFA Putative uncharacterized protein
C1BZX061%Caligus clemensiC1BZX0_9MAXI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
E9C2J862%Capsaspora owczarzakiE9C2J8_CAPO3 Branched chain keto acid dehydrogenase E1
moderate identity ( >40% )
whole range identity ( 0-100% )

clustalW

T-Coffee