Revision history of "MapleSyrupDisease disease causing mutations"

From Bioinformatikpedia

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 22:00, 12 May 2011‎ Demel (talk | contribs)‎ . . (570 bytes) (+570)‎ . . (New page: >sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2 MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAE FIDKLEFIQ...)
Retrieved from "https://i12r-studfilesrv.informatik.tu-muenchen.de/wiki/index.php/MapleSyrupDisease_disease_causing_mutations"