Revision history of "Isoform CRA b"

From Bioinformatikpedia

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 13:12, 23 April 2012Gatzmannf (talk | contribs). . (406 bytes) (+406). . (Created page with ">gi|119610913|gb|EAW90507.1| aspartoacylase (Canavan disease), isoform CRA_b [Homo sapiens] MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSED…")