Revision history of "Isoform CRA a"

From Bioinformatikpedia

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 14:13, 23 April 2012Gatzmannf (talk | contribs). . (409 bytes) (+409). . (Created page with ">gi|119610912|gb|EAW90506.1| aspartoacylase (Canavan disease), isoform CRA_a [Homo sapiens] MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSED…")