Revision history of "Beta-hexosaminidase subunit alpha"

From Bioinformatikpedia

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 10:52, 19 May 2011Link (talk | contribs). . (662 bytes) (-1). . (Fasta Sequence)
  • (cur | prev) 20:44, 13 May 2011Uskat (talk | contribs). . (663 bytes) (+663). . (New page: == Fasta Sequence == <code>>>sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV LDEAFQRY...)